| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK16 |
|---|
| Clone | 2G6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK16 Antibody (2G6) from Novus Biologicals is a mouse monoclonal antibody to STK16. This antibody reacts with human. The STK16 Antibody (2G6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | STK16 (NP_001008910, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPF |
|---|
| Other Names | EC 2.7.11.1, FLJ39635, hPSK, MGC16211, MPSK1, MPSKFLJ39635, Myristoylated and palmitoylated serine/threonine-protein kinase, PKL12KRCT, protein kinase expressed in day 12 fetal liver, Protein kinase PKL12, serine/threonine kinase 16, serine/threonine-protein kinase 16, TGF-beta-stimulated factor 1, TSF1, TSF-1 |
|---|
| Gene, Accession # | STK16, Gene ID: 8576, Accession: NP_001008910, SwissProt: NP_001008910 |
|---|
| Catalog # | H00008576-M03 |
|---|
| Price | |
|---|
| Order / More Info | STK16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|