| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK19. This antibody reacts with human. The STK19 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human STK19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTR |
|---|
| Other Names | D6S60, D6S60E, EC 2.7.11.1, G11nuclear serine/threonine protein kinase, HLA-RP1, MGC117388, MHC class III HLA-RP1, Protein G11, Protein RP1, RP1serine/threonine-protein kinase 19, serine/threonine kinase 19 |
|---|
| Gene, Accession # | STK19, Gene ID: 8859 |
|---|
| Catalog # | NBP2-57152 |
|---|
| Price | |
|---|
| Order / More Info | STK19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|