| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STK35 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STK35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STK35. This antibody reacts with human. The STK35 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STK35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET |
|---|
| Other Names | bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/threonine-protein kinase 35, STK35L1 |
|---|
| Gene, Accession # | STK35, Gene ID: 140901, Accession: Q8TDR2, SwissProt: Q8TDR2 |
|---|
| Catalog # | NBP2-30644 |
|---|
| Price | |
|---|
| Order / More Info | STK35 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|