| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-2 R beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-2 R beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-2 R beta. This antibody reacts with human. The IL-2 R beta Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-2R beta/CD122 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ |
|---|
| Other Names | CD122, CD122 antigen, high affinity IL-2 receptor beta subunit, High affinity IL-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, interleukin 15 receptor, beta, interleukin 2 receptor, beta, interleukin-2 receptor subunit beta, P70-75, p75 |
|---|
| Gene, Accession # | IL2RB, Gene ID: 3560, Accession: P14784, SwissProt: P14784 |
|---|
| Catalog # | NBP2-34148 |
|---|
| Price | |
|---|
| Order / More Info | IL-2 R beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|