| 产品详情 |
| Edit |   |
| Antigenic Specificity | IL-17RD/SEF |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-17RD/SEF Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-17RD/SEF. This antibody reacts with human. The IL-17RD/SEF Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IL-17 RD/SEF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NCSTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKD |
| Other Names | FLJ35755, IL-17RDIL-17 receptor D, IL17Rhom, IL17RLMDKFZp434N1928, interleukin 17 receptor D, interleukin-17 receptor D, Interleukin-17 receptor-like protein, MGC133309, Sef homolog, SEFhSef |
| Gene, Accession # | IL17RD, Gene ID: 54756 |
| Catalog # | NBP2-47420 |
| Price | |
| Order / More Info | IL-17RD/SEF Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|