| Edit |   |
| Antigenic Specificity | ZNF821 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF821 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF821. This antibody reacts with human. The ZNF821 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human LOC55565. Peptide sequence LRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH. |
| Other Names | FLJ16350, zinc finger protein 821 |
| Gene, Accession # | ZNF821, Gene ID: 55565, Accession: NP_060000, SwissProt: NP_060000 |
| Catalog # | NBP1-80335 |
| Price | |
| Order / More Info | ZNF821 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |