| Edit |   |
| Antigenic Specificity | ZNF835 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF835 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF835. This antibody reacts with human. The ZNF835 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human BC37295_3. Peptide sequence ESPKERHPDSRQRERGGGPKKPWKCGDCGKAFSYCSAFILHQRIHTGEKP. |
| Other Names | BC37295_3, zinc finger protein 835 |
| Gene, Accession # | ZNF835, Gene ID: 90485, Accession: NP_001005850, SwissProt: NP_001005850 |
| Catalog # | NBP1-79347-20ul |
| Price | |
| Order / More Info | ZNF835 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |