| Edit |   |
|---|
| Antigenic Specificity | ZNF842 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF842 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF842. This antibody reacts with human. The ZNF842 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF799. Peptide sequence AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA. |
|---|
| Other Names | ZNF842 zinc finger protein 842 |
|---|
| Gene, Accession # | ZNF799, Gene ID: 90576 |
|---|
| Catalog # | NBP1-80202-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF842 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|