| Edit |   |
| Antigenic Specificity | ZNF891 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF891 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF891. This antibody reacts with human. The ZNF891 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human hCG_1646157. Peptide sequence ISPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKMI. |
| Other Names | ZNF891 zinc finger protein 891 |
| Gene, Accession # | ZNF891, Gene ID: 440122 |
| Catalog # | NBP1-91383-20ul |
| Price | |
| Order / More Info | ZNF891 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |