| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. |
|---|
| Immunogen | ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI |
|---|
| Other Names | zgc:85611|F22F7.13|F22F7_13|acyl-CoA binding protein 4|2010009P05Rik|2010015A21Rik|AI849317 |
|---|
| Gene, Accession # | Gene ID: 79777,67131,303577 |
|---|
| Catalog # | ABIN635315 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Binding Domain Containing 4 (ACBD4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|