| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Binding Domain Containing 7 (ACBD7) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of ACBD7 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | ACBD7 antibody was raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD |
|---|
| Other Names | zgc:114176|bA455B2.2|RGD1564164|9230116B18Rik |
|---|
| Gene, Accession # | Gene ID: 414149 |
|---|
| Catalog # | ABIN632041 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Binding Domain Containing 7 (ACBD7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|