| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. |
|---|
| Immunogen | ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA |
|---|
| Other Names | SCAD|acad3|scad|ACADS|ACAD3|Scad|wu:fc44c01|zgc:92400|AI196007|Bcd-1|Bcd1|Hdlq8 |
|---|
| Gene, Accession # | Gene ID: 35,11409,64304 |
|---|
| Catalog # | ABIN630890 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|