| Edit |   |
|---|
| Antigenic Specificity | Adenylate Kinase 2 (AK2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. |
|---|
| Immunogen | AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML |
|---|
| Other Names | ADK-2|BcDNA:SD09634|CG3140|Dak2|Dmel\\CG3140|anon-Dak2|adk2|NV10896|wu:fb34f05|wu:fj80e03|ADK2|AK 2|Ak-2|D4Ertd220e|MXI22.8|MXI22_8 |
|---|
| Gene, Accession # | Gene ID: 204 |
|---|
| Catalog # | ABIN629660 |
|---|
| Price | |
|---|
| Order / More Info | Adenylate Kinase 2 (AK2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|