| Edit |   |
|---|
| Antigenic Specificity | Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. |
|---|
| Immunogen | ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL |
|---|
| Other Names | ACCN3|Accn3|DRASIC|SLNAC1|TNaC1|AW742291|TNAC1 |
|---|
| Gene, Accession # | Gene ID: 9311 |
|---|
| Catalog # | ABIN630092 |
|---|
| Price | |
|---|
| Order / More Info | Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|