| 产品详情 |
| Edit |   |
| Antigenic Specificity | AKD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AKD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKD1. This antibody reacts with human. The AKD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AKD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWG |
| Other Names | adenylate kinase domain containing 1, adenylate kinase domain containing 2, adenylate kinase domain-containing protein 1, Adenylate kinase domain-containing protein 2, AKD2, C6orf199, C6orf224, chromosome 6 open reading frame 199, chromosome 6 open reading frame 224, dJ70A9.1, FLJ16163, FLJ25791, FLJ34784, FLJ42177, MGC126763, MGC138153, MGC177059, MGC180194, MGC184281, MGC26954, RP1-70A9.1 |
| Gene, Accession # | AKD1, Gene ID: 221264, Accession: Q5TCS8, SwissProt: Q5TCS8 |
| Catalog # | NBP2-33936 |
| Price | |
| Order / More Info | AKD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|