| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | c-jun |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The c-jun Antibody from Novus Biologicals is a rabbit polyclonal antibody to c-jun. This antibody reacts with human. The c-jun Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Jun antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT |
|---|
| Other Names | Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian) |
|---|
| Gene, Accession # | JUN, Gene ID: 3725 |
|---|
| Catalog # | NBP2-56932 |
|---|
| Price | |
|---|
| Order / More Info | c-jun Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|