| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Semaphorin 4F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Semaphorin 4F Antibody from Novus Biologicals is a rabbit polyclonal antibody to Semaphorin 4F. This antibody reacts with human. The Semaphorin 4F Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR |
|---|
| Other Names | M-SEMA, m-Sema-M, PRO2353, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4F, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, 4F, Sema M, Sema W, SEMAM, semaphorin-4F, semaphorin-M, Semaphorin-W, SEMAWsemaphorin M |
|---|
| Gene, Accession # | SEMA4F, Gene ID: 10505 |
|---|
| Catalog # | NBP2-68815 |
|---|
| Price | |
|---|
| Order / More Info | Semaphorin 4F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|