| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CBP/KAT3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CBP/KAT3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBP/KAT3A. This antibody reacts with human. The CBP/KAT3A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CBP/KAT3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE |
|---|
| Other Names | CBPRTS, CREB binding protein, CREB-binding protein, EC 2.3.1.48, KAT3A, RSTS, Rubinstein-Taybi syndrome |
|---|
| Gene, Accession # | CREBBP, Gene ID: 1387, Accession: Q92793, SwissProt: Q92793 |
|---|
| Catalog # | NBP2-38774 |
|---|
| Price | |
|---|
| Order / More Info | CBP/KAT3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|