| Edit |   |
| Antigenic Specificity | Abhydrolase Domain Containing 13 (ABHD13) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown. |
| Immunogen | ABHD13 antibody was raised using the C terminal of ABHD13 corresponding to a region with amino acids LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII |
| Other Names | BEM46L1|C13orf6|RP11-153I24.2|bA153I24.2|1110065L07Rik|AI463703|AI788994|RGD1308317|zgc:123286 |
| Gene, Accession # | Gene ID: 84945,68904,306630 |
| Catalog # | ABIN634950 |
| Price | |
| Order / More Info | Abhydrolase Domain Containing 13 (ABHD13) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |