| Edit |   |
|---|
| Antigenic Specificity | HENMT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HENMT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HENMT1. This antibody reacts with human. The HENMT1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESCLS |
|---|
| Other Names | chromosome 1 open reading frame 59, EC 2.1.1.n8, FLJ30525, HEN1 methyltransferase homolog 1, HEN1 methyltransferase homolog 1 (Arabidopsis), HEN1C1orf59hypothetical protein LOC113802, MGC111091 |
|---|
| Gene, Accession # | HENMT1, Gene ID: 113802, Accession: Q5T8I9, SwissProt: Q5T8I9 |
|---|
| Catalog # | NBP1-88328 |
|---|
| Price | |
|---|
| Order / More Info | HENMT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|