| Edit |   |
|---|
| Antigenic Specificity | ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway. |
|---|
| Immunogen | ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN |
|---|
| Other Names | C8orf2|Erlin-2|NET32|SPFH2|SPG18|RGD1309010|Spfh2|BC036333|C87251 |
|---|
| Gene, Accession # | Gene ID: 11160 |
|---|
| Catalog # | ABIN633961 |
|---|
| Price | |
|---|
| Order / More Info | ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|