Edit |   |
Antigenic Specificity | N-Methylpurine-DNA Glycosylase (MPG) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. |
Immunogen | MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
Other Names | BA3871|zgc:162984|si:xx-187g17.9|MPG|MPGR|AAG|ADPG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg|9830006D05|AI326268|Aag |
Gene, Accession # | Gene ID: 4350 |
Catalog # | ABIN635211 |
Price | |
Order / More Info | N-Methylpurine-DNA Glycosylase (MPG) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |