| 产品详情 |
| Edit |   |
| Antigenic Specificity | NIFK |
| Clone | CL2240 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a |
| Format | Protein A purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NIFK Antibody (CL2240) from Novus Biologicals is a mouse monoclonal antibody to NIFK. This antibody reacts with human. The NIFK Antibody (CL2240) has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NIFK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI |
| Other Names | hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67 |
| Gene, Accession # | MKI67IP, Gene ID: 84365, Accession: Q9BYG3, SwissProt: Q9BYG3 |
| Catalog # | NBP2-36749 |
| Price | |
| Order / More Info | NIFK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|