| 产品详情 |
| Edit |   |
| Antigenic Specificity | TL1A/TNFSF15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TL1A/TNFSF15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TL1A/TNFSF15. This antibody reacts with human. The TL1A/TNFSF15 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TL1A/TNFSF15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ |
| Other Names | MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1 |
| Gene, Accession # | TNFSF15, Gene ID: 9966 |
| Catalog # | NBP2-58139 |
| Price | |
| Order / More Info | TL1A/TNFSF15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|