| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Mover |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Mover Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mover. This antibody reacts with human. The Mover Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Mover antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK |
|---|
| Other Names | FAM79A, family with sequence similarity 79, member A, FLJ21811, h-mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER, Protein FAM79A, RP11-46F15.3, tumor protein p63 regulated 1-like, tumor protein p63-regulated gene 1-like protein |
|---|
| Gene, Accession # | TPRG1L, Gene ID: 127262 |
|---|
| Catalog # | NBP2-55810 |
|---|
| Price | |
|---|
| Order / More Info | Mover Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|