| Edit |   |
| Antigenic Specificity | MOX1 |
| Clone | 4E10 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MOX1 Antibody (4E10) from Novus Biologicals is a mouse monoclonal antibody to MOX1. This antibody reacts with human. The MOX1 Antibody (4E10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | MEOX1 (NP_004518, 82 a.a. - 170 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK* |
| Other Names | homeobox protein MOX-1, mesenchyme homeobox 1MOX1mesenchyme homeo box 1 |
| Gene, Accession # | MEOX1, Gene ID: 4222, Accession: NP_004518, SwissProt: NP_004518 |
| Catalog # | H00004222-M27 |
| Price | |
| Order / More Info | MOX1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |