| Edit |   |
|---|
| Antigenic Specificity | MOX1 |
|---|
| Clone | 2E12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against transfected lysate for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOX1 Antibody (2E12) from Novus Biologicals is a mouse monoclonal antibody to MOX1. This antibody reacts with human. The MOX1 Antibody (2E12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | MEOX1 (NP_004518.1 165 a.a. - 252 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS |
|---|
| Other Names | homeobox protein MOX-1, mesenchyme homeobox 1MOX1mesenchyme homeo box 1 |
|---|
| Gene, Accession # | MEOX1, Gene ID: 4222, Accession: NP_004518, SwissProt: NP_004518 |
|---|
| Catalog # | H00004222-M03 |
|---|
| Price | |
|---|
| Order / More Info | MOX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|