| 产品详情 |
| Edit |   |
| Antigenic Specificity | SUMO Activating Enzyme E1 (SAE1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SUMO Activating Enzyme E1 (SAE1) Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUMO Activating Enzyme E1 (SAE1). This antibody reacts with human, mouse, rat. The SUMO Activating Enzyme E1 (SAE1) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SUMO Activating Enzyme E1 (SAE1) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKV DTEDIEKKPESFFTQFDAVCLTCCSRD |
| Other Names | AOS1activator of SUMO1, FLJ3091, HSPC140, Sua1, SUA1sentrin/SUMO-activating protein AOS1, SUMO-1 activating enzyme E1 N subunit, SUMO1 activating enzyme subunit 1, SUMO-1 activating enzyme subunit 1, SUMO-activating enzyme subunit 1, Ubiquitin-like 1-activating enzyme E1A, ubiquitin-like protein SUMO-1 activating enzyme, UBLE1A |
| Gene, Accession # | SAE1, Gene ID: 10055 |
| Catalog # | NBP2-13273 |
| Price | |
| Order / More Info | SUMO Activating Enzyme E1 (SAE1) Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|