| Edit |   |
| Antigenic Specificity | EXOC3-AS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EXOC3-AS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EXOC3-AS1. This antibody reacts with human. The EXOC3-AS1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC116349(hypothetical protein BC014011) The peptide sequence was selected from the N terminal of LOC116349. Peptide sequence PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA. |
| Other Names | chromosome 5 open reading frame 55, hypothetical protein LOC116349 |
| Gene, Accession # | C5orf55, Gene ID: 116349 |
| Catalog # | NBP1-70474 |
| Price | |
| Order / More Info | EXOC3-AS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |