| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Factor XIII |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Factor XIII Antibody from Novus Biologicals is a rabbit polyclonal antibody to Factor XIII. This antibody reacts with human. The Factor XIII Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to F13B(coagulation factor XIII, B polypeptide) The peptide sequence was selected from the middle region of F13B. Peptide sequence LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP. |
|---|
| Other Names | bA525O21.1 (coagulation factor XIII, A1 polypeptide), coagulation factor XIII A chain, coagulation factor XIII, A1 polypeptide, Coagulation factor XIIIa, EC 2.3.2.13, F13Acoagulation factor XIII, A polypeptide, factor XIIIa, fibrin stabilizing factor, A subunit, fibrinoligase, FSF, A subunit, Protein-glutamine gamma-glutamyltransferase A chain, TGase, Transglutaminase A chain, transglutaminase. plasma |
|---|
| Gene, Accession # | F13B, Gene ID: 2165, Accession: P05160, SwissProt: P05160 |
|---|
| Catalog # | NBP1-58012 |
|---|
| Price | |
|---|
| Order / More Info | Factor XIII Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|