| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V0C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V0C Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V0C. This antibody reacts with human. The ATP6V0C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ATP6V0C (NP_001685). Peptide sequence VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG. |
|---|
| Other Names | ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATP6LVPPC, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, ATPL, H(+)-transporting two-sector ATPase, 16 kDa subunit, vacuolar ATP synthase 16 kDa proteolipid subunit, vacuolar H+ ATPase proton channel subunit, Vacuolar proton pump 16 kDa proteolipid subunit, VATL, V-ATPase 16 kDa proteolipid subunit, Vma3, V-type proton ATPase 16 kDa proteolipid subunit |
|---|
| Gene, Accession # | ATP6V0C, Gene ID: 527, Accession: P27449, SwissProt: P27449 |
|---|
| Catalog # | NBP1-59654 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V0C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27732831, 28775146 |
|---|
| 产品资料 |
|
|