| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1C1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1C1. This antibody reacts with human. The ATP6V1C1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: C 1 |
|---|
| Immunogen | Synthetic peptides corresponding to ATP6V1C1(ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1) The peptide sequence was selected from the N terminal of ATP6V1C1. Peptide sequence MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG. |
|---|
| Other Names | ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1 |
|---|
| Gene, Accession # | ATP6V1C1, Gene ID: 528, Accession: P21283, SwissProt: P21283 |
|---|
| Catalog # | NBP1-54902 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1C1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|