| Edit |   |
|---|
| Antigenic Specificity | REXO5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The REXO5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to REXO5. This antibody reacts with human. The REXO5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC81691(exonuclease NEF-sp) The peptide sequence was selected from the middle region of LOC81691. Peptide sequence AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL. |
|---|
| Other Names | DKFZp434J0315, EC 3.1, exonuclease NEF-sp, LOC81691 exonuclease NEF-sp, putative RNA exonuclease NEF-sp |
|---|
| Gene, Accession # | LOC81691, Gene ID: 81691, Accession: Q96IC2, SwissProt: Q96IC2 |
|---|
| Catalog # | NBP1-57704-20ul |
|---|
| Price | |
|---|
| Order / More Info | REXO5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|