| Edit |   |
|---|
| Antigenic Specificity | TCP11 |
|---|
| Clone | 2E3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCP11 Antibody (2E3) from Novus Biologicals is a mouse monoclonal antibody to TCP11. This antibody reacts with human. The TCP11 Antibody (2E3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | TCP11 (NP_061149.1 342 a.a. - 441 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV |
|---|
| Other Names | D6S230E, KIAA0229, MGC111103, t-complex 11 (a murine tcp homolog), t-complex 11 homolog (mouse), T-complex protein 11 homolog |
|---|
| Gene, Accession # | TCP11, Gene ID: 6954, Accession: NP_061149, SwissProt: NP_061149 |
|---|
| Catalog # | H00006954-M07 |
|---|
| Price | |
|---|
| Order / More Info | TCP11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|