| 产品详情 |
| Edit |   |
| Antigenic Specificity | NT5C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in the literature (PMID:28059163). Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NT5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to NT5C. This antibody reacts with human. The NT5C Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NT5C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP |
| Other Names | 3'-pyrimidine nucleotidase, 5' nucleotidase, deoxy (pyrimidine), cytosolic type C, 5', 3'-nucleotidase, cytosolic, cdN, Cytosolic 5', Deoxy-5'-nucleotidase 1, dNT-15'(3')-deoxyribonucleotidase, cytosolic type, DNT1DNT-1, EC 3.1.3.-, P5N2, PN-I, PN-II, UMPH2DNT, uridine 5'-monophosphate phosphohydrolase 2, uridine 5-prime monophosphate hydrolase 2 |
| Gene, Accession # | NT5C, Gene ID: 30833 |
| Catalog # | NBP1-84563 |
| Price | |
| Order / More Info | NT5C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28059163 |
| 产品资料 |
|
|