| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NT5C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NT5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to NT5C. This antibody reacts with human, rat. The NT5C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NT5C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL |
|---|
| Other Names | 3'-pyrimidine nucleotidase, 5' nucleotidase, deoxy (pyrimidine), cytosolic type C, 5', 3'-nucleotidase, cytosolic, cdN, Cytosolic 5', Deoxy-5'-nucleotidase 1, dNT-15'(3')-deoxyribonucleotidase, cytosolic type, DNT1DNT-1, EC 3.1.3.-, P5N2, PN-I, PN-II, UMPH2DNT, uridine 5'-monophosphate phosphohydrolase 2, uridine 5-prime monophosphate hydrolase 2 |
|---|
| Gene, Accession # | NT5C, Gene ID: 30833 |
|---|
| Catalog # | NBP1-84564 |
|---|
| Price | |
|---|
| Order / More Info | NT5C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|