| Edit |   |
| Antigenic Specificity | CNTD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CNTD Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNTD. This antibody reacts with human. The CNTD Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CNTD1 (cyclin N-terminal domain containing 1) The peptide sequence was selected from the N terminal of CNTD1. Peptide sequence QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM. |
| Other Names | CNTD, cyclin N-terminal domain containing, cyclin N-terminal domain containing 1, cyclin N-terminal domain-containing protein 1, FLJ40137 |
| Gene, Accession # | CNTD1, Gene ID: 124817, Accession: Q8N815, SwissProt: Q8N815 |
| Catalog # | NBP1-57048-20ul |
| Price | |
| Order / More Info | CNTD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |