| Edit |   |
|---|
| Antigenic Specificity | CNTD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNTD Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNTD. This antibody reacts with human. The CNTD Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CNTD1 (cyclin N-terminal domain containing 1) The peptide sequence was selected from the N terminal of CNTD1. Peptide sequence QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM. |
|---|
| Other Names | CNTD, cyclin N-terminal domain containing, cyclin N-terminal domain containing 1, cyclin N-terminal domain-containing protein 1, FLJ40137 |
|---|
| Gene, Accession # | CNTD1, Gene ID: 124817, Accession: Q8N815, SwissProt: Q8N815 |
|---|
| Catalog # | NBP1-57048 |
|---|
| Price | |
|---|
| Order / More Info | CNTD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|