| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLR2K |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLR2K Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR2K. This antibody reacts with human. The POLR2K Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human POLR2K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV |
|---|
| Other Names | ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0 |
|---|
| Gene, Accession # | POLR2K, Gene ID: 5440 |
|---|
| Catalog # | NBP2-55856 |
|---|
| Price | |
|---|
| Order / More Info | POLR2K Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|