| 产品详情 |
| Edit |   |
| Antigenic Specificity | POLR2K |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POLR2K Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR2K. This antibody reacts with human. The POLR2K Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: RPABC4 |
| Immunogen | Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025). Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR. |
| Other Names | ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0 |
| Gene, Accession # | POLR2K, Gene ID: 5440, Accession: P53803, SwissProt: P53803 |
| Catalog # | NBP1-55166 |
| Price | |
| Order / More Info | POLR2K Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 17714821 |
| 产品资料 |
|
|