| Edit |   |
|---|
| Antigenic Specificity | UBQLN3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBQLN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBQLN3. This antibody reacts with human. The UBQLN3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UBQLN3(ubiquilin 3) The peptide sequence was selected from the N terminal of UBQLN3. Peptide sequence LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE. |
|---|
| Other Names | TUP-1, ubiquilin 3, ubiquilin-3 |
|---|
| Gene, Accession # | UBQLN3, Gene ID: 50613, Accession: Q9H347, SwissProt: Q9H347 |
|---|
| Catalog # | NBP1-54981 |
|---|
| Price | |
|---|
| Order / More Info | UBQLN3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|