| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BLNK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BLNK Antibody from Novus Biologicals is a rabbit polyclonal antibody to BLNK. This antibody reacts with human. The BLNK Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BLNK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEH SDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP |
|---|
| Other Names | AGM4, B cell linker protein, BASH, B-cell adapter containing a SH2 domain protein, B-cell adapter containing a Src homology 2 domain protein, B-cell linker, B-cell linker protein, BLNK-s, Cytoplasmic adapter protein, LY57, MGC111051, SLP-65BLNK-S, SLP65Ly57, Src homology 2 domain-containing leukocyte protein of 65 kDa |
|---|
| Gene, Accession # | BLNK, Gene ID: 29760 |
|---|
| Catalog # | NBP2-14355 |
|---|
| Price | |
|---|
| Order / More Info | BLNK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|