| 产品详情 |
| Edit |   |
| Antigenic Specificity | Galectin-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Galectin-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Galectin-1. This antibody reacts with human, mouse. The Galectin-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to LGALS1(lectin, galactoside-binding, soluble, 1 (galectin 1)) The peptide sequence was selected from the middle region of LGALS1. Peptide sequence EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM. |
| Other Names | 14 kDa laminin-binding protein, 14 kDa lectin, Beta-galactoside-binding lectin L-14-I, DKFZp686E23103, gal-1, GAL1, Galaptin, galectin 1, galectin-1, GBP, HBL, HLBP14, HPL, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, lectin, galactoside-binding, soluble, 1, Putative MAPK-activating protein PM12, S-Lac lectin 1 |
| Gene, Accession # | LGALS1, Gene ID: 3956, Accession: P09382, SwissProt: P09382 |
| Catalog # | NBP1-59002 |
| Price | |
| Order / More Info | Galectin-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|