Edit |   |
Antigenic Specificity | ElaC Homolog 1 (E. Coli) (ELAC1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA. |
Immunogen | ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN |
Other Names | ELAC1|zgc:91956|2610018O07Rik|8430417G19Rik|D29 |
Gene, Accession # | Gene ID: 55520 |
Catalog # | ABIN631754 |
Price | |
Order / More Info | ElaC Homolog 1 (E. Coli) (ELAC1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |