| 产品详情 |
| Edit |   |
| Antigenic Specificity | NAALADase-2/NAALAD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NAALADase-2/NAALAD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAALADase-2/NAALAD2. This antibody reacts with human. The NAALADase-2/NAALAD2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NAALADase-2/NAALAD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNIN |
| Other Names | GCPIII, glutamate carboxypeptidase III, GPCIII, MGC116996, MGC26353, NAADALASE2, NAALADase II, N-acetylated alpha-linked acidic dipeptidase 2, N-acetylated alpha-linked acidic dipeptidase II, N-acetylated-alpha-linked acidic dipeptidase 2, N-acetylated-alpha-linked acidic dipeptidase II |
| Gene, Accession # | NAALAD2, Gene ID: 10003 |
| Catalog # | NBP2-56951 |
| Price | |
| Order / More Info | NAALADase-2/NAALAD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|