| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VIPR2/VPAC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VIPR2/VPAC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VIPR2/VPAC2. This antibody reacts with human. The VIPR2/VPAC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VIP R2/VPAC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR |
|---|
| Other Names | FLJ16511, Helodermin-preferring VIP receptor, PACAP type III receptor, PACAP-R3, PACAP-R-3, Pituitary adenylate cyclase-activating polypeptide type III receptor, vasoactive intestinal peptide receptor 2, vasoactive intestinal polypeptide receptor 2, VIP2R, VIP-R-2, VPAC2, VPCAP2R |
|---|
| Gene, Accession # | VIPR2, Gene ID: 7434, Accession: P41587, SwissProt: P41587 |
|---|
| Catalog # | NBP2-34149 |
|---|
| Price | |
|---|
| Order / More Info | VIPR2/VPAC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|