| 产品详情 |
| Edit |   |
| Antigenic Specificity | Protein phosphatase 1F |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Protein phosphatase 1F Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein phosphatase 1F. This antibody reacts with human. The Protein phosphatase 1F Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Protein phosphatase 1F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ |
| Other Names | Ca(2+)/calmodulin-dependent protein kinase phosphatase, CaMKPaseCaM-kinase phosphatase, EC 3.1.3.16, FEM-2, hFEM-2, KIAA0015POPX2CAMKP, Partner of PIX 2, PP2C phosphatase, Protein fem-2 homolog, protein phosphatase 1F, protein phosphatase 1F (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1F |
| Gene, Accession # | PPM1F, Gene ID: 9647 |
| Catalog # | NBP1-88206 |
| Price | |
| Order / More Info | Protein phosphatase 1F Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|