| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP-2 beta/TFAP2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID: 28894266). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP-2 beta/TFAP2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP-2 beta/TFAP2B. This antibody reacts with human, mouse. The AP-2 beta/TFAP2B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AP-2 beta/TFAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG |
|---|
| Other Names | activating enhancer binding protein 2 beta, Activating enhancer-binding protein 2-beta, AP-2B, AP2-B, AP2-beta, CHAR, MGC21381, transcription factor AP-2 beta (activating enhancer binding protein 2 beta), transcription factor AP-2 beta (activating enhancer-binding protein 2 beta), transcription factor AP-2-beta |
|---|
| Gene, Accession # | TFAP2B, Gene ID: 7021 |
|---|
| Catalog # | NBP1-89063 |
|---|
| Price | |
|---|
| Order / More Info | AP-2 beta/TFAP2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28894266 |
|---|
| 产品资料 |
|
|