| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHMP4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHMP4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHMP4B. This antibody reacts with human. The CHMP4B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CHMP4B (chromatin modifying protein 4B) The peptide sequence was selected from the middle region of CHMP4B. Peptide sequence RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH. |
|---|
| Other Names | C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, SHAX1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B |
|---|
| Gene, Accession # | CHMP4B, Gene ID: 128866, Accession: Q9H444, SwissProt: Q9H444 |
|---|
| Catalog # | NBP1-56995 |
|---|
| Price | |
|---|
| Order / More Info | CHMP4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|