| Edit |   |
|---|
| Antigenic Specificity | MNDA |
|---|
| Clone | 1H2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MNDA Antibody (1H2) from Novus Biologicals is a mouse monoclonal antibody to MNDA. This antibody reacts with human. The MNDA Antibody (1H2) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MNDA (NP_002423.1 311 a.a. - 407 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN |
|---|
| Other Names | myeloid cell nuclear differentiation antigen, PYHIN3 |
|---|
| Gene, Accession # | MNDA, Gene ID: 4332, Accession: NP_002423, SwissProt: NP_002423 |
|---|
| Catalog # | H00004332-M01 |
|---|
| Price | |
|---|
| Order / More Info | MNDA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|